2jr8
From Proteopedia
Solution structure of Manduca sexta moricin
Structural highlights
FunctionMOR_MANSE Antimicrobial peptide. Active against a broad spectrum of Gram-positive and Gram-negative bacteria including methicillin-resistant S.aureus ATCC 43 300, S.aureus BAA-39, pathogenic strains of L.monocytogenes, K.pneumoniae, E.coli O157:H7, S.typhimurium and multidrug-resistant S.typhimurium DT104 with minimum inhibitory concentration (MIC) of 1.4 uM for all except for S.aureus BAA-39 (PubMed:18265434). Also active against Serratia marcescens (PubMed:14728663). Probably acts by disturbing membrane functions with its amphipathic alpha-helical structure (PubMed:18265434). May protect a developing embryo from bacterial infection (Probable).[1] [2] Publication Abstract from PubMedIn response to wounding or infection, insects produce a battery of antimicrobial peptides (AMPs) and other defense molecules to kill the invading pathogens. To study their structures, functions, and transcriptional regulation, we synthesized Manduca sexta moricin, a 42-residue peptide (GKIPVKAIKQAGKVIGKGLRAINIAGTTHDVVSFFRPKKKKH, 4539 Da). The compound exhibited potent antimicrobial activities against a broad spectrum of Gram-positive and Gram-negative bacteria with a minimum inhibitory concentration of 1.4 microM. The mRNA levels of M. sexta moricin increased substantially in fat body and hemocytes after the larvae were challenged with bacterial cells. We determined the solution structure of this AMP by two-dimensional (1)H--(1)H -nuclear magnetic resonance spectroscopy. The tertiary structure is composed of an eight-turn alpha-helix spanning almost the entire peptide. Insights of relationships between the structure and function are also presented. Copyright (c) 2008 European Peptide Society and John Wiley & Sons, Ltd. Solution structure, antibacterial activity, and expression profile of Manduca sexta moricin.,Dai H, Rayaprolu S, Gong Y, Huang R, Prakash O, Jiang H J Pept Sci. 2008 Feb 11;. PMID:18265434[3] From MEDLINE®/PubMed®, a database of the U.S. National Library of Medicine. References
|
Categories: Large Structures | Manduca sexta | Dai H | Gong Y | Huang R | Jiang H | Prakash O | Rayaprolu S