User:Nikhil Malvankar/Geobacter pilus

From Proteopedia

Jump to: navigation, search

Interactive 3D Complement in Proteopedia

About this image

Image:Blank-white-30x460px.png
Structural basis for metallic-like conductivity in microbial nanowires.

Nikhil S. Malvankar, Madeline Vargas, Kelly Nevin, Pier-Luc Tremblay, Kenneth Evans-Lutterodt, Dmytro Nykypanchuk, Eric Martz, Mark T. Tuominen, Derek R. Lovley. mBio 6(2):e00084-15 (2015). (doi:10.1128/mBio.00084-15)

Contents

Molecular Tour

Geobacter pilus homology model

  Export Animated Image


Theoretical Model: The protein structure described on this page was determined theoretically, and hence should be interpreted with caution.


Download

Pilus Model

Animations for Powerpoint

Click images to see them full size, or to download them.

See Also

Notes & References

  1. A Geobacter sulfurreducens pilin (pilA) homology model was constructed by Swiss-Model, templated on the X-ray crystallographic structure of Pseudomonas aeruginosa pilin (1oqw, chain A). This model represents residues 1-60 of the mature pilin protein (length 61 amino acids: residues 30-90 of Q74D23), sequence FTLIELLIVVAIIGILAAIAIPQFSAYRVKAYNSAASSDLRNLKTALESAFADDQTYPPES. This monomer includes six aromatic residues, F1, F24, Y27, Y32, F51 and Y57.
  2. We employed the NMR structure of Geobacter sulfurreducens pilin, 2m7g. We employed model 5 of this 18-conformer ensemble because model 5 had the best clash score and MolProbity score.
  3. The Geobacter sequence is identical to the template Pseudomonas sequence in 22 of the first 23 residues. Residues 24-50 have 26% sequence identity.
  4. Craig L, Pique ME, Tainer JA. Type IV pilus structure and bacterial pathogenicity. Nat Rev Microbiol. 2004 May;2(5):363-78. PMID:15100690 doi:http://dx.doi.org/10.1038/nrmicro885

Proteopedia Page Contributors and Editors (what is this?)

Eric Martz

Personal tools